PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096164.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 393aa    MW: 43748.6 Da    PI: 5.9675
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096164.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.77.7e-38172267297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     lfqrlwse+Deiv+L+G+id+ +k++++p++d++af++f+kk+++++v+++ql +KirrL++K+ ++++k k+gk+ ++sk+h+qk++els+kiW
  XP_011096164.1 172 LFQRLWSEDDEIVILKGMIDYVTKKKSDPVADLNAFHDFIKKNLHVDVTRTQLQDKIRRLRRKYVNNKSKEKEGKDRTLSKPHEQKAYELSEKIW 266
                     69********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  XP_011096164.1 267 G 267
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.2E-34173267IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MAKNREPEKP VESETESGEE EDDIATSEDA GSQDSDSEPD LAQVSKKPLS STQATPKKAQ  60
PQSSSKPQPQ PPSSSDEEES GSESESDSDE PDPNVKPIAS KPMENEQKSS DGARKLRSKP  120
IASDIVTPAR STAAKRPAEE KETETKDAKK SKKKAEPDTS EKKSTDDSKK LLFQRLWSED  180
DEIVILKGMI DYVTKKKSDP VADLNAFHDF IKKNLHVDVT RTQLQDKIRR LRRKYVNNKS  240
KEKEGKDRTL SKPHEQKAYE LSEKIWGNES GKENGVEKVM GSPKVNGSAL RKTPSKRPNT  300
GENEEAKDVK SVEVVNSDPE RLLPAKRVNS GGVTVEERIL RIGAEYFESG KGLEREKEWK  360
KLSVEEIEVY LRQLEVKTAQ AKLVLDAVKS GGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096164.10.0PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-28DNA-binding storekeeper protein-related transcriptional regulator